PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G24880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 207aa    MW: 21672.2 Da    PI: 8.6217
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G24880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.81.9e-32128186159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK vk+s+fprsYYrCt+++C+vkk+v+r a+d  +v++tYeg Hnh+
  OGLUM05G24880.1 128 LDDGYRWRKYGQKAVKNSDFPRSYYRCTHHTCNVKKQVQRLAKDRGIVVTTYEGVHNHP 186
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.2E-33114186IPR003657WRKY domain
SuperFamilySSF1182901.96E-28120187IPR003657WRKY domain
PROSITE profilePS5081128.38123188IPR003657WRKY domain
SMARTSM007747.2E-37128187IPR003657WRKY domain
PfamPF031068.3E-26129186IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MDGLEAAAGD QQHGRLLIPQ LPAAYLASSS MAALSPAGDD WAASLILPDG GSAAAGVGED  60
DLGGGVMAAA AAESSCGGSS TVTSSGVTEA AAAAATTTRR GRGNGKKAGG GGRTPRFAFH  120
TRSENDILDD GYRWRKYGQK AVKNSDFPRS YYRCTHHTCN VKKQVQRLAK DRGIVVTTYE  180
GVHNHPCEKL MEALSPILRQ LQLLSQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A7e-251211851074Probable WRKY transcription factor 4
1wj2_A7e-251211851074Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1084990.0AC108499.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1187_E11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639822.11e-152PREDICTED: probable WRKY transcription factor 24
SwissprotQ9FFS32e-56WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLA0A0E0A1W51e-152A0A0E0A1W5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PQ861e-152A0A0E0PQ86_ORYRU; Uncharacterized protein
STRINGLOC_Os05g45230.11e-101(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.15e-55WRKY DNA-binding protein 56